PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_01670_BGI-A2_v1.0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family B3
Protein Properties Length: 457aa    MW: 51816.9 Da    PI: 10.7791
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_01670_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B356.84e-18431161692
                                 EE--HHH.HTT..---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE.. CS
                          B3  16 lvlpkkfaeeh..ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefel 92 
                                 l +p  f+ ++  +g  + +k+ +l++ sg+sW+v++  + ++g+y++ +GW++Fvk +gL+ gDf+vF l+++s+f  
  Cotton_A_01670_BGI-A2_v1.0  43 LKIPPAFV-KYvlKG--KVPKKFSLYSDSGNSWRVRV--EVQQGSYFFNSGWSKFVKYHGLEIGDFLVFFLVDSSTFDV 116
                                 78******.774633..35678***************..*******************************998788744 PP

2B344.33.1e-141992771698
                                 EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
                          B3  16 lvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                                 + +p+ fa+e g+ ke+    +++ ++g  W ++   + +++++ l++GW++F ++n++ +gD+++F+++ + ++  +v++++
  Cotton_A_01670_BGI-A2_v1.0 199 VFIPRYFAKETGLGKES--ITMIKGPRGGMWPMNT--TESGRQVRLGGGWSQFLHENDIVVGDTLLFQHIPNAGKLVHVQILN 277
                                 68*********988755..455588**********..********************************98766657787776 PP

3B349.29.6e-163674461699
                                 EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
                          B3  16 lvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                                 + +p + a+e+g+ ke s   +++d++gr+W++++    + +++ l++GW++F ++n+L++gD+++F+++ +++   +++++r
  Cotton_A_01670_BGI-A2_v1.0 367 IPVPTSVAKEMGLTKEPS--TVIKDSKGRKWRLNI--LVYARSVHLGAGWSKFMEENKLEVGDTLLFQHIPNTGNVIYFHIIR 445
                                 446777899999987654..7779***********..9999999**************************8888888999888 PP

                                 S CS
                          B3  99 k 99 
                                 k
  Cotton_A_01670_BGI-A2_v1.0 446 K 446
                                 6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.108.5E-2226124IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086314.43828122IPR003340B3 DNA binding domain
SuperFamilySSF1019367.06E-2328126IPR015300DNA-binding pseudobarrel domain
CDDcd100171.09E-2029120No hitNo description
SMARTSM010194.8E-1431122IPR003340B3 DNA binding domain
PfamPF023629.4E-1642117IPR003340B3 DNA binding domain
SuperFamilySSF1019368.24E-17182273IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.3E-15183278IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.674184279IPR003340B3 DNA binding domain
CDDcd100178.64E-13186277No hitNo description
SMARTSM010191.0E-8187279IPR003340B3 DNA binding domain
PfamPF023622.0E-11199276IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.4E-17347445IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019366.67E-17349446IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086313.112352447IPR003340B3 DNA binding domain
CDDcd100176.21E-12354445No hitNo description
SMARTSM010197.6E-6355447IPR003340B3 DNA binding domain
PfamPF023622.1E-13367446IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 457 aa     Download sequence    Send to blast
MRESKEANEK TEAVNAKLLN MTRKPKRSPS FFRVLVGDFV TKLKIPPAFV KYVLKGKVPK  60
KFSLYSDSGN SWRVRVEVQQ GSYFFNSGWS KFVKYHGLEI GDFLVFFLVD SSTFDVFIYN  120
RTACAKNSIL AAKKPKGRPP GGNRQIEQTP SQKCTSASKK PRAVSRARNV SQEVEFITEE  180
APKHVSFVLV VKKYLKYYVF IPRYFAKETG LGKESITMIK GPRGGMWPMN TTESGRQVRL  240
GGGWSQFLHE NDIVVGDTLL FQHIPNAGKL VHVQILNKAG YRNHGRGGRR GRQNKQANAS  300
EKNTIIAIKQ KRGPPCRQIE EPNSKITKGL SIEGETDITR KDEFESELTP KKASFVVVLK  360
QYQKFYIPVP TSVAKEMGLT KEPSTVIKDS KGRKWRLNIL VYARSVHLGA GWSKFMEENK  420
LEVGDTLLFQ HIPNTGNVIY FHIIRKARDG NHGKRKN
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012472261.10.0PREDICTED: B3 domain-containing protein REM5-like
TrEMBLA0A0D2QEJ40.0A0A0D2QEJ4_G
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14995620
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00260.18e-19B3 family protein